Lineage for d2at4x1 (2at4 X:1-184)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673811Protein Nitrophorin 4 [50845] (1 species)
  7. 673812Species Rhodnius prolixus [TaxId:13249] [50846] (31 PDB entries)
  8. 673826Domain d2at4x1: 2at4 X:1-184 [127280]
    automatically matched to d1d2ua_
    complexed with fde, nh4

Details for d2at4x1

PDB Entry: 2at4 (more details), 1.08 Å

PDB Description: 1.08 A Crystal Structure Of Nitrophorin 4 From Rhodnius Prolixus Containing Fe(III) Deuteroporphyrin IX Complexed With Ammonia at pH 7.5
PDB Compounds: (X:) Nitrophorin 4

SCOP Domain Sequences for d2at4x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2at4x1 b.60.1.1 (X:1-184) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOP Domain Coordinates for d2at4x1:

Click to download the PDB-style file with coordinates for d2at4x1.
(The format of our PDB-style files is described here.)

Timeline for d2at4x1:

  • d2at4x1 is new in SCOP 1.73
  • d2at4x1 does not appear in SCOP 1.75