Class a: All alpha proteins [46456] (284 folds) |
Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) |
Family a.158.1.1: F-box domain [81381] (4 proteins) |
Protein Skp2 [81379] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries) |
Domain d2astb1: 2ast B:2097-2135 [127273] Other proteins in same PDB: d2astb2, d2astc1 automatically matched to d1fs1a1 complexed with ben |
PDB Entry: 2ast (more details), 2.3 Å
SCOP Domain Sequences for d2astb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2astb1 a.158.1.1 (B:2097-2135) Skp2 {Human (Homo sapiens) [TaxId: 9606]} wdslpdelllgifsclclpellkvsgvckrwyrlasdes
Timeline for d2astb1: