Lineage for d2assc1 (2ass C:3005-3073)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869246Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 869247Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 869248Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 869254Protein CksHs1 [55645] (1 species)
  7. 869255Species Human (Homo sapiens) [TaxId:9606] [55646] (5 PDB entries)
  8. 869262Domain d2assc1: 2ass C:3005-3073 [127272]
    Other proteins in same PDB: d2assb1, d2assb2
    automatically matched to d1dksa_
    complexed with ben, po4; mutant

Details for d2assc1

PDB Entry: 2ass (more details), 3 Å

PDB Description: crystal structure of the skp1-skp2-cks1 complex
PDB Compounds: (C:) Cyclin-dependent kinases regulatory subunit 1

SCOP Domain Sequences for d2assc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2assc1 d.97.1.1 (C:3005-3073) CksHs1 {Human (Homo sapiens) [TaxId: 9606]}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrpl

SCOP Domain Coordinates for d2assc1:

Click to download the PDB-style file with coordinates for d2assc1.
(The format of our PDB-style files is described here.)

Timeline for d2assc1: