Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) |
Protein DinB homolog (DBH) [100889] (3 species) |
Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (50 PDB entries) |
Domain d2asdb2: 2asd B:1002-1240 [127251] Other proteins in same PDB: d2asda1, d2asdb1 automatically matched to d1jx4a2 complexed with 8og, ca, dcp, ddg |
PDB Entry: 2asd (more details), 1.95 Å
SCOP Domain Sequences for d2asdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asdb2 e.8.1.7 (B:1002-1240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} ivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagipi veakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyrea ynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldia dvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
Timeline for d2asdb2: