Lineage for d2as5m2 (2as5 M:396-575)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1772172Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1772406Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 1772450Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
  7. 1772451Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
  8. 1772456Domain d2as5m2: 2as5 M:396-575 [127238]
    Other proteins in same PDB: d2as5f_, d2as5g_, d2as5m1, d2as5n1
    automatically matched to d1p7hl2
    protein/DNA complex; complexed with mg

Details for d2as5m2

PDB Entry: 2as5 (more details), 2.7 Å

PDB Description: structure of the dna binding domains of nfat and foxp2 bound specifically to dna.
PDB Compounds: (M:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d2as5m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2as5m2 b.2.5.3 (M:396-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
plewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplg
lqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidc
agilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsah

SCOPe Domain Coordinates for d2as5m2:

Click to download the PDB-style file with coordinates for d2as5m2.
(The format of our PDB-style files is described here.)

Timeline for d2as5m2: