Lineage for d2as5f_ (2as5 F:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260202Species Human (Homo sapiens) [TaxId:9606] [186924] (7 PDB entries)
  8. 1260216Domain d2as5f_: 2as5 F: [127235]
    Other proteins in same PDB: d2as5m1, d2as5m2, d2as5n1, d2as5n2
    automated match to d1d5va_
    protein/DNA complex; complexed with mg

Details for d2as5f_

PDB Entry: 2as5 (more details), 2.7 Å

PDB Description: structure of the dna binding domains of nfat and foxp2 bound specifically to dna.
PDB Compounds: (F:) Forkhead box protein P2

SCOPe Domain Sequences for d2as5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2as5f_ a.4.5.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
fvrvenvkgavwtvdeveyqkrr

SCOPe Domain Coordinates for d2as5f_:

Click to download the PDB-style file with coordinates for d2as5f_.
(The format of our PDB-style files is described here.)

Timeline for d2as5f_: