Lineage for d2aryb1 (2ary B:33-354)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015211Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
  6. 1015212Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species)
    includes the N-terminal 'sequence' domain I
  7. 1015218Species Human (Homo sapiens), mu type [TaxId:9606] [142851] (2 PDB entries)
    Uniprot P07384 33-353! Uniprot P07384 33-354
  8. 1015221Domain d2aryb1: 2ary B:33-354 [127224]
    automatically matched to 2ARY A:33-354
    complexed with bme, ca

Details for d2aryb1

PDB Entry: 2ary (more details), 2.4 Å

PDB Description: Catalytic domain of Human Calpain-1
PDB Compounds: (B:) Calpain-1 catalytic subunit

SCOPe Domain Sequences for d2aryb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aryb1 d.3.1.3 (B:33-354) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), mu type [TaxId: 9606]}
naikylgqdyeqlrvrclqsgtlfrdeafppvpqslgykdlgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlndtllhrvvphgqsfqngyagifhfq
lwqfgewvdvvvddllpikdgklvfvhsaegnefwsallekayakvngsyealsggstse
gfedftggvtewyelrkapsdlyqiilkalergsllgcsidissvldmeaitfkklvkgh
aysvtgakqvnyrgqvvslirmrnpwgevewtgawsdsssewnnvdpyerdqlrvkmedg
efwmsfrdfmreftrleicnlt

SCOPe Domain Coordinates for d2aryb1:

Click to download the PDB-style file with coordinates for d2aryb1.
(The format of our PDB-style files is described here.)

Timeline for d2aryb1: