| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.18: SWIRM domain [140222] (3 proteins) Pfam PF04433; contains extra N-terminal helix |
| Protein Transcriptional adaptor 2-like, TADA2L [140225] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [140226] (3 PDB entries) Uniprot Q8CHV6 343-443! Uniprot Q8CHV6 355-443 |
| Domain d2aqfa1: 2aqf A:2-90 [127180] automatically matched to 2AQE A:2-90 |
PDB Entry: 2aqf (more details)
SCOPe Domain Sequences for d2aqfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aqfa1 a.4.1.18 (A:2-90) Transcriptional adaptor 2-like, TADA2L {Mouse (Mus musculus) [TaxId: 10090]}
snsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrla
qaralikidvnktrkiydfliregyitka
Timeline for d2aqfa1: