SCOP 1.73: Domain d2aqfa1: 2aqf A:2-90

Lineage for d2aqfa1 (2aqf A:2-90)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (3 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein Transcriptional adaptor 2-like, TADA2L [140225] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140226] (3 PDB entries)

8. Domain d2aqfa1: 2aqf A:2-90 [127180]
   automatically matched to 2AQE A:2-90

Details for d2aqfa1

PDB Entry: 2aqf

PDB Description: structural and functional analysis of ada2 alpha swirm domain

PDB Compounds: (A:) Transcriptional adaptor 2, Ada2 alpha

SCOP Domain Sequences for d2aqfa1:

Sequence; same for both SEQRES and ATOM records:

>d2aqfa1 a.4.1.18 (A:2-90) Transcriptional adaptor 2-like, TADA2L {Mouse (Mus musculus) [TaxId: 10090]}
snsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrla
qaralikidvnktrkiydfliregyitka

Timeline for d2aqfa1:

• d2aqfa1 is new in SCOP 1.73
  
• d2aqfa1 appears in SCOP 1.75
  
• d2aqfa1 appears in the current release, SCOPe 2.08, called d2aqfa2