Lineage for d2aq3b2 (2aq3 B:119-235)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639209Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1639210Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1639269Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 1639270Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
    Uniprot P23313
  8. 1639294Domain d2aq3b2: 2aq3 B:119-235 [127149]
    Other proteins in same PDB: d2aq3a1, d2aq3b1, d2aq3c_, d2aq3d1, d2aq3e_, d2aq3f1, d2aq3g_, d2aq3h1
    automated match to d3bvga2

Details for d2aq3b2

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq3b2 d.15.6.1 (B:119-235) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

SCOPe Domain Coordinates for d2aq3b2:

Click to download the PDB-style file with coordinates for d2aq3b2.
(The format of our PDB-style files is described here.)

Timeline for d2aq3b2: