| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins) |
| Protein Streptococcal superantigen SSA [54354] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [54355] (4 PDB entries) |
| Domain d2aq3b2: 2aq3 B:124-235 [127149] Other proteins in same PDB: d2aq3b1, d2aq3d1, d2aq3f1, d2aq3h1 automatically matched to d1bxta2 mutant |
PDB Entry: 2aq3 (more details), 2.3 Å
SCOP Domain Sequences for d2aq3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq3b2 d.15.6.1 (B:124-235) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk
Timeline for d2aq3b2: