Lineage for d2aq2b2 (2aq2 B:124-235)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403556Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1403557Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1403616Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 1403617Species Staphylococcus aureus [TaxId:1280] [54345] (18 PDB entries)
    Uniprot P23313
  8. 1403618Domain d2aq2b2: 2aq2 B:124-235 [127147]
    Other proteins in same PDB: d2aq2a1, d2aq2b1
    automatically matched to d1bxta2
    complexed with na, so4, zn; mutant

Details for d2aq2b2

PDB Entry: 2aq2 (more details), 1.8 Å

PDB Description: crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq2b2 d.15.6.1 (B:124-235) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

SCOPe Domain Coordinates for d2aq2b2:

Click to download the PDB-style file with coordinates for d2aq2b2.
(The format of our PDB-style files is described here.)

Timeline for d2aq2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aq2b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2aq2a1