Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54345] (14 PDB entries) Uniprot P23313 |
Domain d2aq2b2: 2aq2 B:124-235 [127147] Other proteins in same PDB: d2aq2a1, d2aq2b1 automatically matched to d1bxta2 complexed with na, so4, zn; mutant |
PDB Entry: 2aq2 (more details), 1.8 Å
SCOPe Domain Sequences for d2aq2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq2b2 d.15.6.1 (B:124-235) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk
Timeline for d2aq2b2: