Lineage for d2aq1f2 (2aq1 F:124-235)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717870Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 717871Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 717998Protein Streptococcal superantigen SSA [54354] (1 species)
  7. 717999Species Streptococcus pyogenes [TaxId:1314] [54355] (4 PDB entries)
  8. 718005Domain d2aq1f2: 2aq1 F:124-235 [127143]
    Other proteins in same PDB: d2aq1b1, d2aq1d1, d2aq1f1, d2aq1h1
    automatically matched to d1bxta2
    mutant

Details for d2aq1f2

PDB Entry: 2aq1 (more details), 2.1 Å

PDB Description: crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
PDB Compounds: (F:) Enterotoxin type C-3

SCOP Domain Sequences for d2aq1f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq1f2 d.15.6.1 (F:124-235) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

SCOP Domain Coordinates for d2aq1f2:

Click to download the PDB-style file with coordinates for d2aq1f2.
(The format of our PDB-style files is described here.)

Timeline for d2aq1f2: