Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54345] (14 PDB entries) Uniprot P23313 |
Domain d2aq1d2: 2aq1 D:124-235 [127141] Other proteins in same PDB: d2aq1a_, d2aq1b1, d2aq1c_, d2aq1d1, d2aq1e_, d2aq1f1, d2aq1g_, d2aq1h1 automatically matched to d1bxta2 mutant |
PDB Entry: 2aq1 (more details), 2.1 Å
SCOPe Domain Sequences for d2aq1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq1d2 d.15.6.1 (D:124-235) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk
Timeline for d2aq1d2: