SCOP 1.75: Domain d2aowb1: 2aow B:13-292

Lineage for d2aowb1 (2aow B:13-292)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families)

5. Family c.66.1.19: Histamine methyltransferase [75261] (1 protein)

6. Protein Histamine methyltransferase [75262] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75263] (7 PDB entries)

8. Domain d2aowb1: 2aow B:13-292 [127105]
   automatically matched to d1jqea_
   complexed with tha; mutant

Details for d2aowb1

PDB Entry: 2aow, 2.97 Å

PDB Description: histamine methyltransferase (natural variant i105) complexed with the acetylcholinesterase inhibitor and altzheimer's disease drug tacrine

PDB Compounds: (B:) Histamine N-methyltransferase

SCOP Domain Sequences for d2aowb1:

Sequence; same for both SEQRES and ATOM records:

>d2aowb1 c.66.1.19 (B:13-292) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
gkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsigggageidlqils
kvqaqypgvcinnevvepsaeqiakykelvakisnlenvkfawhketsseyqsrmlekke
lqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwdklwkkygsrfpq
ddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdllwdfltetcnfna
tappdlraelgkdlqepefsakkegkvlfnntlsfiviea

Timeline for d2aowb1:

• d2aowb1 first appeared in SCOP 1.73
  
• d2aowb1 is called d2aowb_ in SCOPe 2.01
  
• d2aowb1 appears in the current release, SCOPe 2.08, called d2aowb_