Lineage for d2an3b2 (2an3 B:513-780)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893229Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
    automatically mapped to Pfam PF01234
  6. 2893233Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species)
  7. 2893234Species Human (Homo sapiens) [TaxId:9606] [69549] (8 PDB entries)
  8. 2893238Domain d2an3b2: 2an3 B:513-780 [127028]
    Other proteins in same PDB: d2an3b3
    automated match to d1hnnb_
    complexed with ctl, sah

Details for d2an3b2

PDB Entry: 2an3 (more details), 2.2 Å

PDB Description: Structure of PNMT with S-adenosyl-L-homocysteine and the semi-rigid analogue acceptor substrate cis-(1R,2S)-2-amino-1-tetralol.
PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d2an3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2an3b2 c.66.1.15 (B:513-780) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}
apdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsg
rtlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacl
iegkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdla
sfqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrd
lrtyimpahlqtgvddvkgvffawaqkv

SCOPe Domain Coordinates for d2an3b2:

Click to download the PDB-style file with coordinates for d2an3b2.
(The format of our PDB-style files is described here.)

Timeline for d2an3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2an3b3
View in 3D
Domains from other chains:
(mouse over for more information)
d2an3a_