Lineage for d2ampb1 (2amp B:1-299)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 803590Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 803620Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
    contains an extra alpha-helical domain
  7. 803656Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (3 PDB entries)
  8. 803670Domain d2ampb1: 2amp B:1-299 [127022]
    automatically matched to d1lvod_
    complexed with i12

Details for d2ampb1

PDB Entry: 2amp (more details), 2.7 Å

PDB Description: Crystal Structure Of Porcine Transmissible Gastroenteritis Virus Mpro in Complex with an Inhibitor N1
PDB Compounds: (B:) 3C-like proteinase

SCOP Domain Sequences for d2ampb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ampb1 b.47.1.4 (B:1-299) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus [TaxId: 11149]}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygv

SCOP Domain Coordinates for d2ampb1:

Click to download the PDB-style file with coordinates for d2ampb1.
(The format of our PDB-style files is described here.)

Timeline for d2ampb1: