Lineage for d2alia1 (2ali A:5-134)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858618Family d.38.1.1: 4HBT-like [54638] (18 proteins)
    Pfam PF03061
  6. 858649Protein Hypothetical protein PA2801 [143162] (1 species)
  7. 858650Species Pseudomonas aeruginosa [TaxId:287] [143163] (1 PDB entry)
    Uniprot Q9I042 5-134
  8. 858651Domain d2alia1: 2ali A:5-134 [126976]
    complexed with cl

Details for d2alia1

PDB Entry: 2ali (more details), 1.75 Å

PDB Description: Structure of Protein of Unknown Function PA2801 from Pseudomonas aeruginosa, Putative Thioesterase
PDB Compounds: (A:) hypothetical protein PA2801

SCOP Domain Sequences for d2alia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]}
qllhtahipvrwgdmdsyghvnntlyfqyleearvawfetlgidlegaaegpvvlqslht
ylkpvvhpatvvvelyagrlgtsslvlehrlhtledpqgtygeghcklvwvrhaenrstp
vpdsiraaia

SCOP Domain Coordinates for d2alia1:

Click to download the PDB-style file with coordinates for d2alia1.
(The format of our PDB-style files is described here.)

Timeline for d2alia1: