Lineage for d2alaa1 (2ala A:293-384)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771282Species Semliki forest virus [TaxId:11033] [255033] (1 PDB entry)
  8. 1771283Domain d2alaa1: 2ala A:293-384 [126973]
    Other proteins in same PDB: d2alaa2
    automated match to d3n40f2

Details for d2alaa1

PDB Entry: 2ala (more details), 3 Å

PDB Description: Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric conformation.
PDB Compounds: (A:) Structural polyprotein (P130)

SCOPe Domain Sequences for d2alaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alaa1 b.1.18.0 (A:293-384) automated matches {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasceppk

SCOPe Domain Coordinates for d2alaa1:

Click to download the PDB-style file with coordinates for d2alaa1.
(The format of our PDB-style files is described here.)

Timeline for d2alaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2alaa2