Lineage for d2al3a1 (2al3 A:10-85)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717355Family d.15.1.2: UBX domain [54250] (5 proteins)
    Pfam PF00789
  6. 717369Protein Tether containing UBX domain for GLUT4 (Tug) [142958] (1 species)
  7. 717370Species Mouse (Mus musculus) [TaxId:10090] [142959] (1 PDB entry)
  8. 717371Domain d2al3a1: 2al3 A:10-85 [126957]

Details for d2al3a1

PDB Entry: 2al3 (more details)

PDB Description: solution structure and backbone dynamics of an n-terminal ubiquitin- like domain in the glut4-tethering protein, tug
PDB Compounds: (A:) TUG long isoform

SCOP Domain Sequences for d2al3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]}
savsvlapngrrhtvkvtpstvllqvledtcrrqdfnpseydlkfqrtvldlslqwrfan
lpnnaklemvpvsrsr

SCOP Domain Coordinates for d2al3a1:

Click to download the PDB-style file with coordinates for d2al3a1.
(The format of our PDB-style files is described here.)

Timeline for d2al3a1: