SCOPe 2.07: Domain d2al2b2: 2al2 B:1-141

Lineage for d2al2b2 (2al2 B:1-141)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (10 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries)

8. Domain d2al2b2: 2al2 B:1-141 [126956]
   Other proteins in same PDB: d2al2a1, d2al2b1
   automated match to d2al1a2
   complexed with 2pg, cl, k, mg, pep

Details for d2al2b2

PDB Entry: 2al2, 1.85 Å

PDB Description: crystal structure analysis of enolase mg subunit complex at ph 8.0

PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d2al2b2:

Sequence, based on SEQRES records:

>d2al2b2 d.54.1.1 (B:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkadidvkdqkavddflisldgtanksklganailgvslaasra
aaaekdvplykhladlskskt

Sequence, based on observed residues (ATOM records):

>d2al2b2 d.54.1.1 (B:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgatgvhealemrdgdkskwmgkgv
lhavknvndviapafvkadidvkdqkavddflisldgtanksklganailgvslaasraa
aaekdvplykhladlskskt

Timeline for d2al2b2:

• d2al2b2 first appeared in SCOP 1.73
  
• d2al2b2 appears in SCOPe 2.06
  
• d2al2b2 appears in the current release, SCOPe 2.08