Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries) |
Domain d2akrc2: 2akr C:7-185 [126935] Other proteins in same PDB: d2akra1, d2akrb_, d2akrc1, d2akrd_ automated match to d1onqa2 complexed with cis, nag |
PDB Entry: 2akr (more details), 1.9 Å
SCOPe Domain Sequences for d2akrc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akrc2 d.19.1.1 (C:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d2akrc2:
View in 3D Domains from other chains: (mouse over for more information) d2akra1, d2akra2, d2akrb_, d2akrd_ |