Lineage for d2akra1 (2akr A:186-279)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106653Protein CD1, alpha-3 domain [88615] (4 species)
  7. 1106669Species Mouse (Mus musculus) [TaxId:10090] [88616] (7 PDB entries)
  8. 1106671Domain d2akra1: 2akr A:186-279 [126931]
    Other proteins in same PDB: d2akra2, d2akrb_, d2akrc2, d2akrd_
    automatically matched to d1cd1a1
    complexed with cis, nag

Details for d2akra1

PDB Entry: 2akr (more details), 1.9 Å

PDB Description: Structural basis of sulfatide presentation by mouse CD1d
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d2akra1:

Sequence, based on SEQRES records: (download)

>d2akra1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d2akra1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa
tldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d2akra1:

Click to download the PDB-style file with coordinates for d2akra1.
(The format of our PDB-style files is described here.)

Timeline for d2akra1: