Lineage for d2akma1 (2akm A:140-433)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836769Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2836770Protein Enolase [51606] (11 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2836820Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries)
    Uniprot P09104
  8. 2836833Domain d2akma1: 2akm A:140-433 [126919]
    Other proteins in same PDB: d2akma2, d2akmb2
    automated match to d1te6a1
    complexed with mg, po4, trs

Details for d2akma1

PDB Entry: 2akm (more details), 1.92 Å

PDB Description: Fluoride Inhibition of Enolase: Crystal Structure of the Inhibitory Complex
PDB Compounds: (A:) Gamma enolase

SCOPe Domain Sequences for d2akma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akma1 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl

SCOPe Domain Coordinates for d2akma1:

Click to download the PDB-style file with coordinates for d2akma1.
(The format of our PDB-style files is described here.)

Timeline for d2akma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2akma2