Lineage for d2akea1 (2ake A:97-469)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693367Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 693368Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 693458Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
    overall structure is similar to TyrRS
  7. 693484Species Human (Homo sapiens) [TaxId:9606] [102256] (7 PDB entries)
  8. 693494Domain d2akea1: 2ake A:97-469 [126915]
    automatically matched to d1ulhb_
    complexed with so4, trp

Details for d2akea1

PDB Entry: 2ake (more details), 3.1 Å

PDB Description: structure of human tryptophanyl-trna synthetase in complex with trna(trp)
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOP Domain Sequences for d2akea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akea1 c.26.1.1 (A:97-469) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyav
enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
stffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdv
dvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdei
vkefmtprklsfd

SCOP Domain Coordinates for d2akea1:

Click to download the PDB-style file with coordinates for d2akea1.
(The format of our PDB-style files is described here.)

Timeline for d2akea1: