Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Dynamin G domain [69488] (2 species) the family common core is decorated with large insertions |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [142228] (1 PDB entry) Uniprot P21575 6-304 Dynamin-1 |
Domain d2akab1: 2aka B:6-304 [126914] |
PDB Entry: 2aka (more details), 1.9 Å
SCOPe Domain Sequences for d2akab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} medliplvnrlqdafsaigqnadldlpqiavvggqsagkssvlenfvgrdflprgsgivt rrplvlqlvnstteyaeflhckgkkftdfeevrleieaetdrvtgtnkgispvpinlrvy sphvlnltlvdlpgmtkvpvgdqppdiefqirdmlmqfvtkenclilavspansdlansd alkiakevdpqgqrtigvitkldlmdegtdardvlenkllplrrgyigvvnrsqkdidgk kditaalaaerkfflshpsyrhladrmgtpylqkvlnqqltnhirdtlpglrnklqsql
Timeline for d2akab1: