Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (185 PDB entries) Uniprot P61769 21-119 Uniprot P01884 Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d2ak4r1: 2ak4 R:1-99 [126911] Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4i1, d2ak4i2, d2ak4j1, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4n1, d2ak4n2, d2ak4p1, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2 automatically matched to d1a9bb_ complexed with iod |
PDB Entry: 2ak4 (more details), 2.5 Å
SCOP Domain Sequences for d2ak4r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak4r1 b.1.1.2 (R:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2ak4r1:
View in 3D Domains from other chains: (mouse over for more information) d2ak4a1, d2ak4a2, d2ak4b1, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g1, d2ak4i1, d2ak4i2, d2ak4j1, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l1, d2ak4n1, d2ak4n2, d2ak4p1, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2 |