Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries) Uniprot P30685 25-300 Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor Uniprot P30481 25-300 Uniprot P01892 25-298 Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor |
Domain d2ak4q1: 2ak4 Q:182-276 [126909] Other proteins in same PDB: d2ak4a2, d2ak4b1, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f2, d2ak4g1, d2ak4i1, d2ak4i2, d2ak4j1, d2ak4j2, d2ak4k2, d2ak4l1, d2ak4n1, d2ak4n2, d2ak4p1, d2ak4p2, d2ak4q2, d2ak4r1, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2 automatically matched to d1a1ma1 complexed with iod |
PDB Entry: 2ak4 (more details), 2.5 Å
SCOP Domain Sequences for d2ak4q1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak4q1 b.1.1.2 (Q:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf qkwaavvvpsgeeqrytchvqheglpkpltlrwep
Timeline for d2ak4q1:
View in 3D Domains from other chains: (mouse over for more information) d2ak4a1, d2ak4a2, d2ak4b1, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g1, d2ak4i1, d2ak4i2, d2ak4j1, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l1, d2ak4n1, d2ak4n2, d2ak4p1, d2ak4p2, d2ak4r1, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2 |