Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) |
Family d.92.1.5: Neurolysin-like [55505] (4 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein Angiotensin converting enzyme 2, ACE2 [103125] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103126] (3 PDB entries) |
Domain d2ajfa1: 2ajf A:19-615 [126882] Other proteins in same PDB: d2ajfe1, d2ajff1 automatically matched to d1r42a_ complexed with bma, cl, nag, zn |
PDB Entry: 2ajf (more details), 2.9 Å
SCOP Domain Sequences for d2ajfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ajfa1 d.92.1.5 (A:19-615) Angiotensin converting enzyme 2, ACE2 {Human (Homo sapiens) [TaxId: 9606]} stieeqaktfldkfnheaedlfyqsslaswnyntniteenvqnmnnagdkwsaflkeqst laqmyplqeiqnltvklqlqalqqngssvlsedkskrlntilntmstiystgkvcnpdnp qeclllepglneimansldynerlwaweswrsevgkqlrplyeeyvvlknemaranhyed ygdywrgdyevngvdgydysrgqliedvehtfeeikplyehlhayvraklmnaypsyisp igclpahllgdmwgrfwtnlysltvpfgqkpnidvtdamvdqawdaqrifkeaekffvsv glpnmtqgfwensmltdpgnvqkavchptawdlgkgdfrilmctkvtmddfltahhemgh iqydmayaaqpfllrnganegfheavgeimslsaatpkhlksigllspdfqedneteinf llkqaltivgtlpftymlekwrwmvfkgeipkdqwmkkwwemkreivgvvepvphdetyc dpaslfhvsndysfiryytrtlyqfqfqealcqaakhegplhkcdisnsteagqklfnml rlgksepwtlalenvvgaknmnvrpllnyfeplftwlkdqnknsfvgwstdwspyad
Timeline for d2ajfa1: