Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins) N-terminal domain is a 8-bladed beta-propeller automatically mapped to Pfam PF00326 |
Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [89771] (8 PDB entries) |
Domain d2ajba2: 2ajb A:509-766 [126859] Other proteins in same PDB: d2ajba1, d2ajbb1, d2ajbc1, d2ajbd1 automated match to d1orva2 complexed with 0qg, nag, so4 |
PDB Entry: 2ajb (more details), 2.75 Å
SCOPe Domain Sequences for d2ajba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ajba2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah qhiythmshflkqcfslp
Timeline for d2ajba2: