Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c552 [46636] (6 species) |
Species Hydrogenobacter thermophilus [TaxId:940] [46640] (9 PDB entries) |
Domain d2ai5a_: 2ai5 A: [126817] automated match to d1ynra_ complexed with hec |
PDB Entry: 2ai5 (more details)
SCOPe Domain Sequences for d2ai5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ai5a_ a.3.1.1 (A:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]} neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp pqnvtdaeakqlaqwilsik
Timeline for d2ai5a_: