SCOPe 2.08: Domain d2ai5a_: 2ai5 A:

Lineage for d2ai5a_ (2ai5 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c552 [46636] (6 species)

7. Species Hydrogenobacter thermophilus [TaxId:940] [46640] (9 PDB entries)

8. Domain d2ai5a_: 2ai5 A: [126817]
   automated match to d1ynra_
   complexed with hec

Details for d2ai5a_

PDB Entry: 2ai5

PDB Description: solution structure of cytochrome c552, determined by distributed computing implementation for nmr data

PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d2ai5a_:

Sequence; same for both SEQRES and ATOM records:

>d2ai5a_ a.3.1.1 (A:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsik

Timeline for d2ai5a_:

• d2ai5a_ first appeared in SCOP 1.73, called d2ai5a1
  
• d2ai5a_ appears in SCOPe 2.07