SCOP 1.73: Domain d2ahob2: 2aho B:1-84

Lineage for d2ahob2 (2aho B:1-84)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141310] (1 PDB entry)

8. Domain d2ahob2: 2aho B:1-84 [126771]
   Other proteins in same PDB: d2ahoa1, d2ahoa2, d2ahoa3, d2ahob1, d2ahob3
   complexed with gnp, mg, zn

Details for d2ahob2

PDB Entry: 2aho, 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp

PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOP Domain Sequences for d2ahob2:

Sequence, based on SEQRES records:

>d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke
nrkvivkvirvdrrkgtvdvslkk

Sequence, based on observed residues (ATOM records):

>d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsnirdvlkenrkvi
vkvirvdrrkgtvdvslkk

Timeline for d2ahob2:

• d2ahob2 is new in SCOP 1.73
  
• d2ahob2 appears in SCOP 1.75
  
• d2ahob2 appears in the current release, SCOPe 2.08