Lineage for d2ahob2 (2aho B:1-84)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789725Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (3 species)
  7. 2789731Species Sulfolobus solfataricus [TaxId:2287] [141310] (2 PDB entries)
    Uniprot Q97Z79 1-84
  8. 2789736Domain d2ahob2: 2aho B:1-84 [126771]
    Other proteins in same PDB: d2ahoa1, d2ahoa2, d2ahoa3, d2ahob1, d2ahob3
    complexed with gnp, mg, zn

Details for d2ahob2

PDB Entry: 2aho (more details), 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2ahob2:

Sequence, based on SEQRES records: (download)

>d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke
nrkvivkvirvdrrkgtvdvslkk

Sequence, based on observed residues (ATOM records): (download)

>d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsnirdvlkenrkvi
vkvirvdrrkgtvdvslkk

SCOPe Domain Coordinates for d2ahob2:

Click to download the PDB-style file with coordinates for d2ahob2.
(The format of our PDB-style files is described here.)

Timeline for d2ahob2: