SCOPe 2.06: Domain d2ahoa2: 2aho A:321-415

Lineage for d2ahoa2 (2aho A:321-415)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Initiation factor eIF2 gamma subunit [74964] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
   Uniprot Q980A5 321-415

8. Domain d2ahoa2: 2aho A:321-415 [126768]
   Other proteins in same PDB: d2ahoa1, d2ahoa3, d2ahob1, d2ahob2, d2ahob3
   complexed with gnp, mg, zn

Details for d2ahoa2

PDB Entry: 2aho, 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp

PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2ahoa2:

Sequence; same for both SEQRES and ATOM records:

>d2ahoa2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

Timeline for d2ahoa2:

• d2ahoa2 first appeared in SCOP 1.73
  
• d2ahoa2 appears in SCOPe 2.05
  
• d2ahoa2 appears in SCOPe 2.07
  
• d2ahoa2 appears in the current release, SCOPe 2.08