Lineage for d2ahmd_ (2ahm D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908608Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 908780Superfamily a.8.9: Coronavirus NSP7-like [140367] (1 family) (S)
  5. 908781Family a.8.9.1: Coronavirus NSP7-like [140368] (2 proteins)
  6. 908786Protein automated matches [190477] (1 species)
    not a true protein
  7. 908787Species SARS coronavirus [TaxId:227859] [187402] (1 PDB entry)
  8. 908790Domain d2ahmd_: 2ahm D: [126763]
    Other proteins in same PDB: d2ahma1, d2ahme1, d2ahmg1, d2ahmh1
    automated match to d1ysya1
    complexed with gol, so4

Details for d2ahmd_

PDB Entry: 2ahm (more details), 2.4 Å

PDB Description: Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer
PDB Compounds: (D:) Replicase polyprotein 1ab, light chain

SCOPe Domain Sequences for d2ahmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahmd_ a.8.9.1 (D:) automated matches {SARS coronavirus [TaxId: 227859]}
gplgsskmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsl
lsvllsmqgavdinrl

SCOPe Domain Coordinates for d2ahmd_:

Click to download the PDB-style file with coordinates for d2ahmd_.
(The format of our PDB-style files is described here.)

Timeline for d2ahmd_: