SCOP 1.75: Domain d2ahmc1: 2ahm C:6-78

Lineage for d2ahmc1 (2ahm C:6-78)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.9: Coronavirus NSP7-like [140367] (1 family)

5. Family a.8.9.1: Coronavirus NSP7-like [140368] (1 protein)

6. Protein Nonstructural protein 7, NSP7 [140369] (1 species)

7. Species SARS coronavirus [TaxId:227859] [140370] (2 PDB entries)
   Uniprot P59641 3837-3909! Uniprot P59641 3837-3919

8. Domain d2ahmc1: 2ahm C:6-78 [126762]
   Other proteins in same PDB: d2ahme1, d2ahmg1, d2ahmh1
   automatically matched to 2AHM A:6-78
   complexed with gol, so4

Details for d2ahmc1

PDB Entry: 2ahm, 2.4 Å

PDB Description: Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer

PDB Compounds: (C:) Replicase polyprotein 1ab, light chain

SCOP Domain Sequences for d2ahmc1:

Sequence; same for both SEQRES and ATOM records:

>d2ahmc1 a.8.9.1 (C:6-78) Nonstructural protein 7, NSP7 {SARS coronavirus [TaxId: 227859]}
skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvll
smqgavdinrlce

Timeline for d2ahmc1:

• d2ahmc1 first appeared in SCOP 1.73
  
• d2ahmc1 is called d2ahmc_ in SCOPe 2.01
  
• d2ahmc1 appears in the current release, SCOPe 2.08, called d2ahmc2