Lineage for d2ah2a1 (2ah2 A:409-633)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 795205Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 795206Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 795207Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89271] (12 PDB entries)
    Uniprot Q26966
  8. 795208Domain d2ah2a1: 2ah2 A:409-633 [126739]
    Other proteins in same PDB: d2ah2a2
    automatically matched to d1mr5a1
    complexed with cl, fsi, gol, ipa; mutant

Details for d2ah2a1

PDB Entry: 2ah2 (more details), 1.6 Å

PDB Description: trypanosoma cruzi trans-sialidase in complex with 2,3-difluorosialic acid (covalent intermediate)
PDB Compounds: (A:) Trans-sialidase

SCOP Domain Sequences for d2ah2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ah2a1 b.29.1.15 (A:409-633) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahm

SCOP Domain Coordinates for d2ah2a1:

Click to download the PDB-style file with coordinates for d2ah2a1.
(The format of our PDB-style files is described here.)

Timeline for d2ah2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ah2a2