SCOP 1.73: Domain d2agjl1: 2agj L:1-108

Lineage for d2agjl1 (2agj L:1-108)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (29 PDB entries)

8. Domain d2agjl1: 2agj L:1-108 [126727]
   Other proteins in same PDB: d2agjl2
   automatically matched to d1rhha1
   complexed with nag

Details for d2agjl1

PDB Entry: 2agj, 2.6 Å

PDB Description: crystal structure of a glycosylated fab from an igm cryoglobulin with properties of a natural proteolytic antibody

PDB Compounds: (L:) Yvo Fab, Light Chain

SCOP Domain Sequences for d2agjl1:

Sequence; same for both SEQRES and ATOM records:

>d2agjl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
eivltqspgtlslspgeratlscrasetvsndkvawyqqkpgqaprlliygassratgip
drfsgsgsgtdftlsisglepedfvvyycqqyassprtfgqgtkveik

Timeline for d2agjl1:

• d2agjl1 is new in SCOP 1.73
  
• d2agjl1 appears in SCOP 1.75
  
• d2agjl1 appears in the current release, SCOPe 2.08