Lineage for d2ag5c_ (2ag5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847061Domain d2ag5c_: 2ag5 C: [126721]
    Other proteins in same PDB: d2ag5a1, d2ag5a2, d2ag5b3
    automated match to d1nffa_
    complexed with nad, so4

Details for d2ag5c_

PDB Entry: 2ag5 (more details), 1.84 Å

PDB Description: Crystal Structure of Human DHRS6
PDB Compounds: (C:) dehydrogenase/reductase (SDR family) member 6

SCOPe Domain Sequences for d2ag5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ag5c_ c.2.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvtk
kkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkml
aqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtvd
tpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviidg
gwsl

SCOPe Domain Coordinates for d2ag5c_:

Click to download the PDB-style file with coordinates for d2ag5c_.
(The format of our PDB-style files is described here.)

Timeline for d2ag5c_: