Lineage for d2ag5b2 (2ag5 B:2-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107789Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2107793Domain d2ag5b2: 2ag5 B:2-245 [126720]
    Other proteins in same PDB: d2ag5a1, d2ag5a2, d2ag5b3
    automated match to d1nffa_
    complexed with nad, so4

Details for d2ag5b2

PDB Entry: 2ag5 (more details), 1.84 Å

PDB Description: Crystal Structure of Human DHRS6
PDB Compounds: (B:) dehydrogenase/reductase (SDR family) member 6

SCOPe Domain Sequences for d2ag5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ag5b2 c.2.1.0 (B:2-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvtk
kkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkml
aqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtvd
tpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviidg
gwsl

SCOPe Domain Coordinates for d2ag5b2:

Click to download the PDB-style file with coordinates for d2ag5b2.
(The format of our PDB-style files is described here.)

Timeline for d2ag5b2: