SCOP 1.73: Domain d2afhc1: 2afh C:5-480

Lineage for d2afhc1 (2afh C:5-480)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.92: Chelatase-like [53799] (2 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (4 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
   contains three domains of this fold; "Helical backbone" holds domains 2 and 3
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3

6. Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [81398] (13 PDB entries)

8. Domain d2afhc1: 2afh C:5-480 [126681]
   Other proteins in same PDB: d2afhb1, d2afhd1, d2afhe1, d2afhf1
   automatically matched to d1m34a_
   complexed with 1pe, ca, cfn, clf, hca, na, p6g, peg, pg4, pge, sf4, trs

Details for d2afhc1

PDB Entry: 2afh, 2.1 Å

PDB Description: crystal structure of nucleotide-free av2-av1 complex

PDB Compounds: (C:) Nitrogenase molybdenum-iron protein

SCOP Domain Sequences for d2afhc1:

Sequence; same for both SEQRES and ATOM records:

>d2afhc1 c.92.2.3 (C:5-480) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]}
sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

Timeline for d2afhc1:

• d2afhc1 is new in SCOP 1.73
  
• d2afhc1 appears in SCOP 1.75
  
• d2afhc1 appears in the current release, SCOPe 2.08, called d2afhc_