Lineage for d2af7e_ (2af7 E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100583Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 1100584Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 1100614Family a.152.1.2: CMD-like [101468] (2 proteins)
    Pfam PF02627; hexamer of single-domain subunits
  6. 1100615Protein Gamma-carboxymuconolactone decarboxylase, CMD [140968] (1 species)
  7. 1100616Species Methanobacterium thermoautotrophicum [TaxId:145262] [140969] (1 PDB entry)
    Uniprot O26336 1-119
  8. 1100621Domain d2af7e_: 2af7 E: [126662]
    automated match to d2af7a1

Details for d2af7e_

PDB Entry: 2af7 (more details), 2.81 Å

PDB Description: Crystal structure of the gamma-carboxymuconolactone decarboxylase from Methanobacterium thermoautotrophicum. Northeast Structural Genomics Consortium target TT747.
PDB Compounds: (E:) gamma-carboxymuconolactone decarboxylase

SCOPe Domain Sequences for d2af7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2af7e_ a.152.1.2 (E:) Gamma-carboxymuconolactone decarboxylase, CMD {Methanobacterium thermoautotrophicum [TaxId: 145262]}
meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften

SCOPe Domain Coordinates for d2af7e_:

Click to download the PDB-style file with coordinates for d2af7e_.
(The format of our PDB-style files is described here.)

Timeline for d2af7e_: