Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Factor IX (IXa) [57198] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries) |
Domain d2aerl1: 2aer L:46-82 [126641] Other proteins in same PDB: d2aerh_, d2aerl3, d2aert1, d2aert2 automatically matched to d1pfxl1 complexed with ben, ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2aer (more details), 1.87 Å
SCOPe Domain Sequences for d2aerl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aerl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} dgdqcasspcqnggsckdqlqsyicfclpafegrnce
Timeline for d2aerl1: