Lineage for d2aeph1 (2aep H:114-190)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655462Domain d2aeph1: 2aep H:114-190 [126639]
    automatically matched to d1mh5b2
    complexed with bma, ca, glc, man, nag, so4

Details for d2aeph1

PDB Entry: 2aep (more details), 2.1 Å

PDB Description: an epidemiologically significant epitope of a 1998 influenza virus neuraminidase forms a highly hydrated interface in the na-antibody complex.
PDB Compounds: (H:) Fab heavy chain

SCOP Domain Sequences for d2aeph1:

Sequence, based on SEQRES records: (download)

>d2aeph1 b.1.1.2 (H:114-190) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsss

Sequence, based on observed residues (ATOM records): (download)

>d2aeph1 b.1.1.2 (H:114-190) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
aktfpepvtltgvhtfpatlsss

SCOP Domain Coordinates for d2aeph1:

Click to download the PDB-style file with coordinates for d2aeph1.
(The format of our PDB-style files is described here.)

Timeline for d2aeph1: