SCOP 1.73: Domain d2aeob1: 2aeo B:1-151

Lineage for d2aeob1 (2aeo B:1-151)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (17 PDB entries)

8. Domain d2aeob1: 2aeo B:1-151 [126638]
   automatically matched to d1cbja_
   complexed with cu, ncp, zn

Details for d2aeob1

PDB Entry: 2aeo, 1.8 Å

PDB Description: crystal structure of cisplatinated bovine cu,zn superoxide dismutase

PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOP Domain Sequences for d2aeob1:

Sequence; same for both SEQRES and ATOM records:

>d2aeob1 b.1.8.1 (B:1-151) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d2aeob1:

• d2aeob1 is new in SCOP 1.73
  
• d2aeob1 appears in SCOP 1.75
  
• d2aeob1 appears in the current release, SCOPe 2.08, called d2aeob_