Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries) Uniprot P13726 33-242 |
Domain d2aeit2: 2aei T:109-209 [126636] Other proteins in same PDB: d2aeih_, d2aeil1, d2aeil2, d2aeil3 automatically matched to d1a21a2 complexed with 03r, ca, cac |
PDB Entry: 2aei (more details), 2.52 Å
SCOPe Domain Sequences for d2aeit2:
Sequence, based on SEQRES records: (download)
>d2aeit2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec
>d2aeit2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksgkktaktn tneflidvdkgenycfsvqavipsrtvnrkstdspvec
Timeline for d2aeit2:
View in 3D Domains from other chains: (mouse over for more information) d2aeih_, d2aeil1, d2aeil2, d2aeil3 |