Lineage for d2aehb3 (2aeh B:33-130)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893548Family d.15.1.4: First domain of FERM [54256] (7 proteins)
  6. 1893558Protein Focal adhesion kinase 1 [142960] (1 species)
  7. 1893559Species Chicken (Gallus gallus) [TaxId:9031] [142961] (2 PDB entries)
    Uniprot Q00944 31-130
  8. 1893563Domain d2aehb3: 2aeh B:33-130 [126630]
    Other proteins in same PDB: d2aeha1, d2aeha2, d2aehb1, d2aehb2
    automated match to d2al6b3

Details for d2aehb3

PDB Entry: 2aeh (more details), 2.53 Å

PDB Description: Focal adhesion kinase 1
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2aehb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aehb3 d.15.1.4 (B:33-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
mervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqs
eevhwlhldmgvsnvrekfelahppeewkyelrirylp

SCOPe Domain Coordinates for d2aehb3:

Click to download the PDB-style file with coordinates for d2aehb3.
(The format of our PDB-style files is described here.)

Timeline for d2aehb3: