Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein) duplication; there are two structural repeats of this fold |
Protein Imidazole glycerol phosphate dehydratase [102767] (3 species) |
Species Staphylococcus aureus [TaxId:1280] [142927] (1 PDB entry) |
Domain d2ae8f1: 2ae8 F:1-84 [126614] automatically matched to 2AE8 A:1-84 complexed with mg |
PDB Entry: 2ae8 (more details), 2.01 Å
SCOP Domain Sequences for d2ae8f1:
Sequence, based on SEQRES records: (download)
>d2ae8f1 d.14.1.9 (F:1-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]} miyqkqrntaetqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgdidvd dhhvtedigivigqlllemikdkk
>d2ae8f1 d.14.1.9 (F:1-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]} miyqkqrtqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgdhhvtedig ivigqlllemikdkk
Timeline for d2ae8f1: