Lineage for d2ae8f1 (2ae8 F:1-84)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716989Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein)
    duplication; there are two structural repeats of this fold
  6. 716990Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)
  7. 716996Species Staphylococcus aureus [TaxId:1280] [142927] (1 PDB entry)
  8. 717007Domain d2ae8f1: 2ae8 F:1-84 [126614]
    automatically matched to 2AE8 A:1-84
    complexed with mg

Details for d2ae8f1

PDB Entry: 2ae8 (more details), 2.01 Å

PDB Description: crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315
PDB Compounds: (F:) Imidazoleglycerol-phosphate dehydratase

SCOP Domain Sequences for d2ae8f1:

Sequence, based on SEQRES records: (download)

>d2ae8f1 d.14.1.9 (F:1-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
miyqkqrntaetqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgdidvd
dhhvtedigivigqlllemikdkk

Sequence, based on observed residues (ATOM records): (download)

>d2ae8f1 d.14.1.9 (F:1-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
miyqkqrtqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgdhhvtedig
ivigqlllemikdkk

SCOP Domain Coordinates for d2ae8f1:

Click to download the PDB-style file with coordinates for d2ae8f1.
(The format of our PDB-style files is described here.)

Timeline for d2ae8f1: