SCOPe 2.04: Domain d2ae8e1: 2ae8 E:0-84

Lineage for d2ae8e1 (2ae8 E:0-84)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
   duplication; there are two structural repeats of this fold

6. Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)

7. Species Staphylococcus aureus [TaxId:1280] [142927] (1 PDB entry)
   Uniprot P64373 1-84! Uniprot P64373 85-179

8. Domain d2ae8e1: 2ae8 E:0-84 [126612]
   automated match to d2ae8a1
   complexed with mg

Details for d2ae8e1

PDB Entry: 2ae8, 2.01 Å

PDB Description: crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315

PDB Compounds: (E:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d2ae8e1:

Sequence, based on SEQRES records:

>d2ae8e1 d.14.1.9 (E:0-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
amiyqkqrntaetqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgdidv
ddhhvtedigivigqlllemikdkk

Sequence, based on observed residues (ATOM records):

>d2ae8e1 d.14.1.9 (E:0-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
amiyqkqrnqlnisisddqspshintgvgflnhmltlftfhsglslnieaqddhhvtedi
givigqlllemikdkk

Timeline for d2ae8e1:

• d2ae8e1 first appeared in SCOP 1.73
  
• d2ae8e1 appears in SCOPe 2.03
  
• d2ae8e1 appears in SCOPe 2.05
  
• d2ae8e1 appears in the current release, SCOPe 2.08